Scaffold Ga0209929_1036171

Overview

Basic Information

• Taxon OID: 3300026187
• Scaffold ID: Ga0209929_1036171
• Source Dataset Name: Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1466
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4973
  • Long. (^o): -122.1295
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045095	Metagenome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209929_10361713	F045095	N/A	MKTIYKATQQDINMPVDKEWQKRFIKYICWGLPQFTFWMIMLTHFLFYVIRGN