Scaffold Ga0208275_1098239

Overview

Basic Information

• Taxon OID: 3300026182
• Scaffold ID: Ga0208275_1098239
• Source Dataset Name: Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 556
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Eastern Tropical North Pacific
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013575	Metagenome	270	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208275_10982393	F013575	AGGA	MNLTWFYFHCVLALVVLVKDYNGTLEESLNNFEKSIGLYTYVDTSHREEEVPFYIPSTSEVDSTWILPD