NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209942_1016736

Scaffold Ga0209942_1016736


Overview

Basic Information
Taxon OID3300026157 Open in IMG/M
Scaffold IDGa0209942_1016736 Open in IMG/M
Source Dataset NameSalt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D2_MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2742
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location NameSouth San Francisco, USA
CoordinatesLat. (o)37.4969Long. (o)-122.1331Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007072Metagenome358Y
F042291Metagenome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0209942_10167363F007072AGGAGGMLERRSITEYNKEKRKGQISLGDAPSVVMIVGFVFLIMATIAYVSEQYGDALTENGSAANITDDLESELSDNTSIAGIVLTISLVGIVLSVLIGIFVSSRRGGM
Ga0209942_10167367F042291AGGAGMPIYQAYNKNIKAWVKYKFAKGKGFKPLNVKEREPKVPFKGIPKKGQRRKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.