Scaffold Ga0208815_1013825

Overview

Basic Information

• Taxon OID: 3300026134
• Scaffold ID: Ga0208815_1013825
• Source Dataset Name: Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1101
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → Virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates
  • Lat. (^o): -9.4986
  • Long. (^o): -25.9999

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001416	Metagenome / Metatranscriptome	699	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208815_10138251	F001416	AGGAG	MPLIKKKLSIAAGAKSDNVFANTTYQTVSAGTNLIVAAAVDTAGTATADTTMDFNVNNAEFANDASVSTLVTGEPFGWNNTAYVLNNMTTQ