NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208815_1004183

Scaffold Ga0208815_1004183


Overview

Basic Information
Taxon OID3300026134 Open in IMG/M
Scaffold IDGa0208815_1004183 Open in IMG/M
Source Dataset NameMarine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2429
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)-9.4986Long. (o)-25.9999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000613Metagenome / Metatranscriptome985Y
F039704Metagenome / Metatranscriptome163Y
F043982Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0208815_10041832F043982N/AMHQFLLYSVIFVSCISFLLALIACARVGKFINSTNGLDWSSVANITGDLATLKKTIQTLNNRMNGMHSPKIAEQELMMQLLNKQQNQQLNGKIQGG
Ga0208815_10041834F000613AGGAGMPLVKKKLSIAAGATSDQVLAGTTYEYVDPGTRIVVAAAVDTAGTATADTTMDFTVNNAEFSKNASVSTLVSGQPFGWSGTGYVMNDMVTTGQVRNRPVITFNNGTAGTRTVDVAVFIGG
Ga0208815_10041835F039704N/AEQLVAILLKRFRNDGPVVTKAALRKTRSTIRKMKTMCDMYDDLRPTARRRSPMRKARSTTTLIKN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.