NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207966_1027954

Scaffold Ga0207966_1027954


Overview

Basic Information
Taxon OID3300026119 Open in IMG/M
Scaffold IDGa0207966_1027954 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1634
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured Mediterranean phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000245Metagenome / Metatranscriptome1468Y
F006919Metagenome362Y

Sequences

Protein IDFamilyRBSSequence
Ga0207966_10279542F006919GAGMKSFKQHLKEFVSYSTSDLVFMNNGQGSASSGLMLPISGPMFKRIWPDTIRTTVFHTTDLRGLEKLKKLEGGKKTISAFFSMMSRYMEGGIASGGGIVIEMEADVLVSAADDIMSQVDNKGRRWVEVSWFANAQRGGTGPAFGKVERELNDLIRNLVVKHLEPILGNRARTDHEYVLWGNMKRELKDSKKLSLVIKDYFDGVEKIIKKNKEVMGNIFYGYAKSKRQTEQAWDEQIVNNIKITKVHIIDFTTKAPSLKGQFDASKDFAYVAGWPMKVWDATETTDLEIYTRQVAQAEVRTR
Ga0207966_10279543F000245N/AETKLDDKLDKLVSDEIKKRKLAKFPVNATDDIKMRRGKPAFKFPSPNSDMMIHVFLRPMEGKKGMMAFNYQLEDK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.