NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209953_1000006

Scaffold Ga0209953_1000006


Overview

Basic Information
Taxon OID3300026097 Open in IMG/M
Scaffold IDGa0209953_1000006 Open in IMG/M
Source Dataset NameSalt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)154976
Total Scaffold Genes141 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)108 (76.60%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location NameSouth San Francisco, USA
CoordinatesLat. (o)37.4958Long. (o)-122.1331Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007226Metagenome / Metatranscriptome355Y
F032045Metagenome / Metatranscriptome181Y
F041087Metagenome / Metatranscriptome160Y
F041504Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0209953_100000617F041504GAGGMSITLLQHIESLNAQADLLMEQEPGLWMSKYTDDMSHWADMGVYTVEDFKRSQLINGISDASKDLYGCRMRLAWDEMSIEQMESTYENICAQLNAQYEEEKAAAEWEAECKRGLPDDCKPLPYEDYAYLEEV
Ga0209953_100000622F041087GGAGGMDLWDRVIEQLRKDIEEGEVMPMYEMLQQVPKDVLIAYLPEEEAADVG
Ga0209953_100000624F032045GGAGMTQYNEKAVDEAIKRDPRIKGKEAKLIKALLKGRKQ
Ga0209953_10000064F007226GAGGMQKLLNKITFYFLQRAYAQMEATGDLQNADDVAEHVEDYFTYFVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.