| Basic Information | |
|---|---|
| Taxon OID | 3300026092 Open in IMG/M |
| Scaffold ID | Ga0207965_1017845 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1816 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073664 | Metagenome / Metatranscriptome | 120 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207965_10178453 | F073664 | AGGAG | VSEGNVEGLPDGQSDEDLVLADLAAIVDQGHLRLRRERQLRRLGRALQRLGITGITGGSWTDLDENAEIVFNPIRADRFIMLIAHLEDLADLIKHQKQVPAPVTVGGVHIHHVEQLQINFLFGTQPPTTG |
| ⦗Top⦘ |