NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208880_1000036

Scaffold Ga0208880_1000036


Overview

Basic Information
Taxon OID3300026085 Open in IMG/M
Scaffold IDGa0208880_1000036 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24953
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)32 (84.21%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012180Metagenome / Metatranscriptome283Y
F046081Metagenome / Metatranscriptome152Y
F057761Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0208880_100003613F046081AGGTGGMFWRKGSYEFIQDSEVELESKLSFVDVKDLSEGSCAFIENITDERVIVHWFDKTDPTKLVNTQELNQPMFINTAHPVTLKNLGDKSAVVRYVDLNTVIENYTGI
Ga0208880_100003615F057761GAGGMLEKKFNLKQYNGPPYSYSVKVNGKLKRMSGFDEEHIKIQLYPRKATMIRKVKDEI
Ga0208880_10000369F012180AGGAMKINHTKTAIGGLFIVIIAFAFLILTTKANAEELTLEQRVSKLENKTSSYDIPEGFFINGEVEAYYDDKTYDSGWDSRGYLQLGISTEVPKNNLSIDWVGGTTKIDSHYSLDRTQDNKLVEKQLGFGNDFARWYIGETDAQRMGFAKTPKISAPLIYTETNYRIDHREKTVLTFGGWQYDNEFDFDSYRLKRETPWGVALGYDNDNNVAYATGTVSLMGYADVSYMRITGPEETTKGDQEGYAIGGSLHRFGVPMLWGVEIWDDKNTGLASDDRMDYGVMYNINKQTYVTAHRTENDDLGYDGNYYGIVHNIYNNYDPSKRPDKQDGLELGLYLHDKEQTSVYTGAHTDYGQQIIGSIRYKF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.