Scaffold Ga0208261_1020550

Overview

Basic Information

• Taxon OID: 3300026076
• Scaffold ID: Ga0208261_1020550
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1957
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -0.4612
  • Long. (^o): -23.033259

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007227	Metagenome / Metatranscriptome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208261_10205503	F007227	GGAG	MHRLSKDEIGYLTTDKIVKMWLLNPHDHHFLYQRADGSYYGFTHMKGEDPEEWFWEAHGIQLELFPPEPPKSHKFTQEQLDRAPHHNILEKYYGKGWKPKAVEGLEDHY