NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208261_1012871

Scaffold Ga0208261_1012871


Overview

Basic Information
Taxon OID3300026076 Open in IMG/M
Scaffold IDGa0208261_1012871 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2559
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-0.4612Long. (o)-23.033259Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017554Metagenome / Metatranscriptome240Y
F047111Metagenome / Metatranscriptome150Y
F049032Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0208261_10128715F047111GAGGMQLTAKSIVLDYYPIKNGNSNILPDKFLRILSFKGETQTKRIVNEAQMNEEILDRVSNYNYNVTDNLLNLPQFHTLGGAL
Ga0208261_10128717F017554N/AMNTTIMYSFPDDLKYRYMSFDTYQKALKCIELFKQIEVKAEVKV
Ga0208261_10128719F049032AGGAGGMINTNNYSQNRGSEVINKLTDYSYNVNMYEEILHYYVTEKYTVFPQIIHNSCGKSI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.