Scaffold Ga0207961_1072859

Overview

Basic Information

• Taxon OID: 3300026073
• Scaffold ID: Ga0207961_1072859
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 747
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): -0.015038
  • Long. (^o): -22.962334

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036420	Metagenome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207961_10728591	F036420	GAG	MRVNVKARMIDTKLRVALYAMTEFAMSKLVPSSRLRNNVSINIHLKHHCEGGEAMLEDYANPYRPRDFKVIIDHHRAEIDDYGRERDATEWAHEIL