NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208535_1016281

Scaffold Ga0208535_1016281


Overview

Basic Information
Taxon OID3300026045 Open in IMG/M
Scaffold IDGa0208535_1016281 Open in IMG/M
Source Dataset NameNatural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)700
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: Antioch, San Francisco Bay, California
CoordinatesLat. (o)38.052479Long. (o)-121.7687Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012310Metagenome / Metatranscriptome282Y

Sequences

Protein IDFamilyRBSSequence
Ga0208535_10162812F012310N/ASKISPADYARHLRAIGQELEALHFSHFNLELIGDAYVVWVKPGDPTETNNPLLRISKSRLQKLWRHRASHRTTGDEGSYAVPPTGKRLRYSVQELDRIERKQRARRQQQSGTADGHSLSQLLRTLGDLVGRKSERLLGITWQELSVGVVVETQQGRREIDVFRPDNLYDLWVRMYLKRHNRAFIDNPR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.