NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207661_10316713

Scaffold Ga0207661_10316713


Overview

Basic Information
Taxon OID3300025944 Open in IMG/M
Scaffold IDGa0207661_10316713 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1402
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006575Metagenome / Metatranscriptome370Y
F007126Metagenome / Metatranscriptome357Y
F012935Metagenome / Metatranscriptome276Y

Sequences

Protein IDFamilyRBSSequence
Ga0207661_103167131F012935N/AFLIAGMHRWHELLAEGDYGRPSETSARLVRLADKGPDAGIHVVAWTDGYATAERALRRAGIGFFGLRAVLRVLSPAESDALLGVAAAASLDDDRALYRDTEWPVEQEEKFKPYSTASLIAFATEGFLSTHD
Ga0207661_103167132F006575GAGMTDAASPYLALRQAVRPAILACRLLAGDQERAGKLATECEDLLFLSGELLKAAGRARLLGPVPGTGSMVPNDDGGERHAQLVDAYADAGLLWAKVVGSCLALAGALIEREDWDDVRALASFLASSGEETAAAELRLVLGNAIWQRHSEQLRVISNTMPPAAIGDAISALRAVLREVPEEYPDRNREVNRFLPPLAAAVGALMKEQQVEIPYHSRVEHIATGGVAKYPDIVAMSLDELAAEFEGLCRRPGRDTT
Ga0207661_103167133F007126AGGAGMSGVVNDIEALAEFRSHLMRFNHDLAENFSTIQSHWRELGEVWRDDMYRLFGEALEEVLPGITAYLEATEGHEAHLAALI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.