NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207711_11281416

Scaffold Ga0207711_11281416


Overview

Basic Information
Taxon OID3300025941 Open in IMG/M
Scaffold IDGa0207711_11281416 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)675
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025770Metagenome / Metatranscriptome200Y
F027147Metagenome / Metatranscriptome195Y

Sequences

Protein IDFamilyRBSSequence
Ga0207711_112814161F027147GAGVIRRDRLARNRDVALTTLIDLLVQVIFVLALILVAADVGGNESRERGWVTPEVWKTLISIFDVDPRHVREPNAQVAAIKDKYEQLQDDLAACETKSSACDKPAGRGPGYAPCRDASGVEMVVAEAVIDSDGRIV
Ga0207711_112814162F025770N/AITKAGAGLHALTEMTERAVQLGKDAVTTQARLSAQISGPLADQLRRHSEAAGALASRLQEDLQASEEAVRRVHHHLIDASRFILSKVEYRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.