NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207665_10000108

Scaffold Ga0207665_10000108


Overview

Basic Information
Taxon OID3300025939 Open in IMG/M
Scaffold IDGa0207665_10000108 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)54035
Total Scaffold Genes53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)44 (83.02%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000239Metagenome / Metatranscriptome1488Y
F000274Metagenome / Metatranscriptome1399Y
F000417Metagenome / Metatranscriptome1165Y
F062122Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0207665_1000010815F000239GGAGGMDESKRHVVRFLEKEIKTYMALSLFLSKKGINAHVRVGEKKVLISPAFYKDRMKEAKKLVYELRKPN
Ga0207665_1000010822F062122AGGMNSLSRFLWSLFLPRLPRLGPEDIAGTAEYCNRLARLDEASMNPPREWRGRISMQLALHIQRFETAEKVSQEILRHAAQQQSCGATAGH
Ga0207665_1000010835F000274GGAGGMKVKITMAFLALFMFVATAGQAAAQDTTKTTHKKTRTLTGCLQKGDDANEFQLTTAKGGTWEIKSDTLKLVNHVGHTVTITGVVSNAKMHGMKEDAKAEAKEHGVDKDSTEHGHMTVTYLKMASDTCKK
Ga0207665_1000010847F000417GGAMIRQLCISVCLALVPTAIPLRAANRPHAGADNQKLKVWTNEDLEKLHALGLISIVGKVDEETSVPQYAPGDYGTTRDPRWYAEQAARLRGELERRQARLDEYRQAIEDARSLKTTAAGINLEEGDLGITPEAGIEILQQRVKEAQAELDDVEDLARRNDIEPGALRGQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.