NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207686_10046794

Scaffold Ga0207686_10046794


Overview

Basic Information
Taxon OID3300025934 Open in IMG/M
Scaffold IDGa0207686_10046794 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2671
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012927Metagenome / Metatranscriptome276Y
F015272Metagenome / Metatranscriptome256Y
F017897Metagenome / Metatranscriptome238Y

Sequences

Protein IDFamilyRBSSequence
Ga0207686_100467941F017897N/AMKLSQITIVLLADRRHSQTAKALKGMGYRLVTTFTPDHAVAMCVNNPVDIVILDQEHFIQTEGWSVAQSLKLIRRSLCVILVVRGRIVGSDLPAGVDAVVPDHDPVALTATLKHMLKGF
Ga0207686_100467942F012927GAGGMTAYALLLVILALISASALYFFLGRLSSFPCRTIRDVPAFLQPVDSAGIMQLLNPQTEEYLHSAMTGVALRLEQRKSLHFMREHLLRMSHNAHILLEWSNAELKRQIVGQSEEDGECYRDCARQLHAAAIEFRLFAILSLIKINLWLVFRTQAWLPLSAPSLAELNHLGSLRFFELHSNLTRAVSALGRHYGTEFRDELLRAWAVAA
Ga0207686_100467943F015272N/AVRRRAYKRFPFFFIYTVFAVIAELCKFAIAQYSQPSMKYFYAYWGAEAIYAALGFLAIHEVFRRVFENFKSLSWFKFLLPMVGLGMLAISSLISIVHRAVETAPFLEGIYSLQIAVRCLQIGVFFLIFFLARAFELDYRQYAFGIAVGFGIAAAGILLGTLVRTGLGLKSLMFFQYVPIVSYCIAVTVWLVSFIRPEPEDPFRDFRHLFTPELFLGRLERYKQDVRGMFKP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.