NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207686_10000335

Scaffold Ga0207686_10000335


Overview

Basic Information
Taxon OID3300025934 Open in IMG/M
Scaffold IDGa0207686_10000335 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33878
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (68.97%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029214Metagenome / Metatranscriptome189Y
F101977Metagenome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0207686_1000033515F029214GAGGMTNSTTTSTHSVNQNSARASRKASDAAPMVVTRLSGWIDVNEMKAEPRGWIIPTRIHHSA
Ga0207686_1000033526F101977GAGMTKQKTEFHFPRDVLVIEIDRRCAAEDCRARNQVSLTKLEAIEYRGFACSECEIWNDDRLTQSEMPDSWNEGSIH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.