| Basic Information | |
|---|---|
| Taxon OID | 3300025930 Open in IMG/M |
| Scaffold ID | Ga0207701_10010782 Open in IMG/M |
| Source Dataset Name | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8999 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (54.55%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kellogg Biological Station, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034609 | Metagenome | 174 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207701_100107829 | F034609 | AGGAG | MAQEHMSDDFDWVGAQAKCSAALMFERLQTHVEEDVRRRNGLLGRPDGWKFEFYAEDDADVFEVSRLLGNGKVAAVVQFERVGRRIHIQGEDIDVDLTAIVTVDTSGMCRFVVGEAMYSDWELRRMALELLFFEEVEEPE |
| ⦗Top⦘ |