NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207700_10086326

Scaffold Ga0207700_10086326


Overview

Basic Information
Taxon OID3300025928 Open in IMG/M
Scaffold IDGa0207700_10086326 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2466
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012927Metagenome / Metatranscriptome276Y
F015272Metagenome / Metatranscriptome256Y
F017897Metagenome / Metatranscriptome238Y

Sequences

Protein IDFamilyRBSSequence
Ga0207700_100863261F015272N/ATLFAIVAEITKFVVHDPQKNTWTNFWIFWGSEAIYAVLGFLAIYEVFRYVFENFQHLAWFRFLLPATGAIMLGIAVLIPIVHRAVDTDALLEDIFALQVAVRCLQLGVFFLIFLLARIFDLDYRQYAFGIAAGFGIIVVGILLSTLVRTGFGLKFLMFFRYVQSVAYCTAVTVWLASFVRAEPDDPFRDFRHLFTPQLFAEQLRRYKQEVRSIFRP
Ga0207700_100863262F012927AGGAGMSAYVFLLILLALVCASALYLFFGSLSRFPCRTIRDVPAFLQPVDSASMIQLLNPETEEYLHSAMTSLALRLEQRRSLHFLREHLMRMSHNAHILLEWSNAELKREIVGQNETDSECYRDCARRLHTAAVEFRLYAVLSRIKINLWLAFRTQTWMPLPVPSLAELSQVAGLRFFTLYSNLTRAVSELGRHYGNEFRDELLRAWTVAA
Ga0207700_100863263F017897N/AMKGSHTTIVLLADRRHSQTARVLKGSGYRLVTTYTPDHAVAICVNNPVDAVILDQEHFIQTEGWSVAQSLKLIRNSLCVVLVVRGKIVGSDLPTGVDAVVPDHDAQALLATLKHMLKGF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.