NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207684_10004016

Scaffold Ga0207684_10004016


Overview

Basic Information
Taxon OID3300025910 Open in IMG/M
Scaffold IDGa0207684_10004016 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14066
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026319Metagenome / Metatranscriptome198Y
F034254Metagenome / Metatranscriptome175Y
F052083Metagenome / Metatranscriptome143N
F074435Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0207684_1000401611F052083GGAGMKMACLAQAQQALAAQRAASAGGRLADVDAYGQTLKDKMACVDTANQDLLRLQTQAGPAKAALFVSEDRFHQEYRQGLQAQLGALQRVSEQLVDQDAVTYEKFAPQVEALKRQTDVLRNRYIRLLNEADTQDLAKAVFQASDLLIASAGTWKEQVKAERDVTEWAPKGPSAHLSRAEAARDAARTQRAGQWEAAQRLISEAAALATTR
Ga0207684_1000401612F034254AGGAGGMTFQSANGYMLLETGPAYMIMRAPIVGEVFVEWKSQQEWQARPPDAGRWELEVRRDVDALKGHRQTVLVLGRYTLTYWPWEVVRKLLLLNRKATRRSGA
Ga0207684_100040162F074435GGAGGMADGQFIQIASVALHLHQGTVRETMVTVLYALDSLGNVWKLADQSGQKWMLMTNER
Ga0207684_100040163F026319GGAGMSYNVMESMVRQRLREKKGQVYCADCLAKDLEQDPVEVGAAMDALASRQNFSAGSCPCGQTGLMLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.