NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207684_10001116

Scaffold Ga0207684_10001116


Overview

Basic Information
Taxon OID3300025910 Open in IMG/M
Scaffold IDGa0207684_10001116 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)29985
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (83.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011956Metagenome / Metatranscriptome285N
F015846Metagenome / Metatranscriptome251Y
F069108Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0207684_1000111613F069108GGAMWAGIVYGTLLERNGNHILLSDGAQICLDDAVQCDFPVGTYLKVTYAEINGRKFARDISQSDSFHALDAPS
Ga0207684_1000111626F011956AGGMTPSVVTLQEVLRHHRTLSRRGREFYESLLAHGDVLAVRLDYLPGAMLWLVTTPKQARLMRKAREGRTTSDVCVMSLAEAQELFTTVGDPTPTTLYEVAAWLLAPAPGDFSTPAPEEPEDPTSL
Ga0207684_1000111637F015846AGGAGVNVLVLDETLELSAPVRELANLHGWQPHFVGSLHEVELAVQAHGRPALLVVNLQPPLTGWELGQRLRGLGLESPVVVLGARGPEGEA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.