Scaffold Ga0207685_10113023

Overview

Basic Information

• Taxon OID: 3300025905
• Scaffold ID: Ga0207685_10113023
• Source Dataset Name: Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1180
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan: Kellogg Biological Station
• Coordinates
  • Lat. (^o): 42.4774
  • Long. (^o): -85.451

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010962	Metagenome / Metatranscriptome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207685_101130233	F010962	AGG	MAKCPTCEHDVTTPFFLNANAWRWLTCPHCAARLERKNPRSVVVLMPLWVGLIAFARLGHRFEVVAEVLMAAITAVILVEFMRPQLQLRKPLPKPETKLNLSGPSN