NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207647_10088794

Scaffold Ga0207647_10088794


Overview

Basic Information
Taxon OID3300025904 Open in IMG/M
Scaffold IDGa0207647_10088794 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1845
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047523Metagenome / Metatranscriptome149N
F097678Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0207647_100887942F097678AGGAGGMKPNPKWTAATLVVLAAATVSTMHALAIAPVPMVHESDGASANGSKTYDEWQAPLSRSFRARFLDHRTAEDPIVGGAPGGFTLRIFDGLEKMQIWDNAP
Ga0207647_100887943F047523GAGGMTGFITGLKSVEEVEAGIFEVVVTLQRGATAKLRMNTFTFQAFVTKFIDGPRPERWLDKSIYVLKKIFAPLRHSQKRQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.