| Basic Information | |
|---|---|
| Taxon OID | 3300025894 Open in IMG/M |
| Scaffold ID | Ga0209335_10199376 Open in IMG/M |
| Source Dataset Name | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 920 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Helgoland, sampling site Kabeltonne | |||||||
| Coordinates | Lat. (o) | 54.184167 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078400 | Metagenome | 116 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209335_101993762 | F078400 | AGGA | MSFSQQSVYINAESGLVVMEANAEQSDSFNPDHPTDRLCSINWCTEGSITVYAKDMTLINTYGVAEKMTITNSDHLSFGRCLLVCMSETAKYYCLHNSHSNAIYYSGDVIQLSANEERTFTGNNGHFIFCSLGSLTNLDKFSMTTIDSDSYTVTAGTEGAIITVFYDSTDD |
| ⦗Top⦘ |