Scaffold Ga0209631_10493471

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209631_10493471

Scaffold Ga0209631_10493471

Overview

Basic Information
Taxon OID	3300025890 Open in IMG/M
Scaffold ID	Ga0209631_10493471 Open in IMG/M
Source Dataset Name	Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	546
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location Name	Helgoland, sampling site Kabeltonne
Coordinates	Lat. (^o)	54.184167	Long. (^o)	7.9	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047063	Metagenome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209631_104934711	F047063	N/A	ITKEADKIAIEYNKTKDSGLRDQWYKLLKQVPQESLDSPPSHT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.