NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209309_10135364

Scaffold Ga0209309_10135364


Overview

Basic Information
Taxon OID3300025881 Open in IMG/M
Scaffold IDGa0209309_10135364 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1271
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033629Metagenome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0209309_101353641F033629N/AKTKPGQTITFKSGFQLYLSGRTLSNVIDESGDAVAAKKPTNDQQEDGFIINLKEGKMLENLQINKKISFQFGKDWYNSFTKSFDAFTSKIIKKTDLSNYEFYRDSDNKKLEMLNQITDPAILPSSKDNWNPSDVWAVKIDQKTRLAKEIDKLYTARIKNNNVSIERINKFIETQFKNKSLIGISLKQVLGSSANVDKITKDAKYIDSVKFLGFKNKMEFDVLQTYFDINVKMSCIKNNTLDYLFRFRPRGSSSATTNNGEGRLSGSGPADGAIDKKNVLSVLLPNADDITKEKYGKSKTILEALNFLVASKKYKGLQTWVNKGSYKFLKIKNLDKKGDDKLIRRGLLNLNYAYLIDTYKDQKELYKKFYLAAKKVNEFSSIHYKISG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.