Scaffold Ga0209533_1054170

Overview

Basic Information

• Taxon OID: 3300025874
• Scaffold ID: Ga0209533_1054170
• Source Dataset Name: Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2310
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Aphanothecaceae → Gloeothece → Gloeothece verrucosa → Gloeothece verrucosa PCC 7822 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Helgoland, sampling site Kabeltonne
• Coordinates
  • Lat. (^o): 54.184167
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002804	Metagenome / Metatranscriptome	529	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209533_10541702	F002804	GGAG	MDYLLNAYIVITSLVTAASVIANYTETPKDDAAIKKLYDLLEMFAFLKGGKAKQK