NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209533_1001019

Scaffold Ga0209533_1001019


Overview

Basic Information
Taxon OID3300025874 Open in IMG/M
Scaffold IDGa0209533_1001019 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26447
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017048Metagenome / Metatranscriptome243Y
F031650Metagenome / Metatranscriptome182Y
F064103Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0209533_100101910F017048N/AMSSFNYEPSKSSLRADTVVEFVQRSLLEFKMKEIPGMGPASIEKFGNHGIYTPAQIVAKFLSFVDAPDVQAQEVCNRFYNWANPIMGKANTHNLTFAMANYAGEHGLFNFDM
Ga0209533_100101913F031650N/AMPTITLEEFNQIKQAYFDAIPEGDAIRAQLKTHSKDQKARHAKIYQYMRENDVMSTDLGGVTFEREEKTTVPAVSLKTLEEIIENPAVVEQYKRDYAKTKESLKVRKPKRQRVDE
Ga0209533_100101922F064103N/AMYARWFAGIFMGICFVLQVRNFNKYRVEKRRKHDEAQVYLNSDVCVDAVTRSQLGTFNLCERAEHIVNESPTEAAFYDIVNDWYPCGHGRCDGFGDWLYSNLHWFVMMILVTSMMFYFKYVEHQRDILYTKMRLPLNLQNAQHVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.