Scaffold Ga0209757_10096603

Overview

Basic Information

• Taxon OID: 3300025873
• Scaffold ID: Ga0209757_10096603
• Source Dataset Name: Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 902
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 18.92
  • Long. (^o): -104.89
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002963	Metagenome / Metatranscriptome	517	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209757_100966032	F002963	GAGG	MIDYNIVLYIGLFLIIGGFCLFLYSQMRLRQLDIELWKNEQLLKSFSKAKRKEKNDLK