| Basic Information | |
|---|---|
| Taxon OID | 3300025864 Open in IMG/M |
| Scaffold ID | Ga0209429_10099873 Open in IMG/M |
| Source Dataset Name | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1273 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Barrow Environmental Observatory site, Barrow, Alaska, USA | |||||||
| Coordinates | Lat. (o) | 71.2905 | Long. (o) | -156.788708 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048198 | Metagenome / Metatranscriptome | 148 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209429_100998733 | F048198 | N/A | ISDQNCGSSGPWLPSRLYCPAGSSLTMATSAPLLVTRRLMNYSARLRVQPASPRGSPIYSARPFTPCRHPYSGGSSNCIRRCLHCWYCLRHLCTGSATTDPTIPEHVGCVTKLQHSLYATAWRCCLPCSGQGFYDRASAGRVAPSRVGYDWMVHRHLPSPDFHWLDGQPYGLRAKIA |
| ⦗Top⦘ |