Scaffold Ga0209483_1000452

Overview

Basic Information

• Taxon OID: 3300025862
• Scaffold ID: Ga0209483_1000452
• Source Dataset Name: Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 36312
• Total Scaffold Genes: 39
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 29 (74.36%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: USA: Barrow Environmental Observatory site, Alaska
• Coordinates
  • Lat. (^o): 71.299
  • Long. (^o): -156.61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064963	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209483_100045217	F064963	N/A	MRLWVELGAGKDRVPDMSPFDLSAGQSSRVGFVSTSGAPDVKWIRPDRQAYLPPPMSKTAIRERSERANALIVIVLTFACTALAIFDLFLLASGS