Scaffold Ga0209605_1039530

Overview

Basic Information

• Taxon OID: 3300025861
• Scaffold ID: Ga0209605_1039530
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2205
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 39.84
  • Long. (^o): -89.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045118	Metagenome / Metatranscriptome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209605_10395301	F045118	N/A	SRVDTFKNIEPEEPFSSYFSLFSLLKARKAHQRGYGTTFLVANSSQEFCVYDKLQEMREHGLETSELPETMRFEHRALKKEKVRSLYGFTRVNELFHGGYEVVKEKQVENWKNSLFSFSAEEVVVLGSKQLEQEMKAFQEKFGSNWFQYFLKSYGAYSLAKFAGKEVVRAALENLNSERTKVWRTMKLLEEAERELLVLKQEEGSSKTLGELYEELREKVCELE