Basic Information | |
---|---|
Taxon OID | 3300025860 Open in IMG/M |
Scaffold ID | Ga0209119_1200381 Open in IMG/M |
Source Dataset Name | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 775 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Helgoland, sampling site Kabeltonne | |||||||
Coordinates | Lat. (o) | 54.184167 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104466 | Metagenome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209119_12003812 | F104466 | GAGG | MATRKINEDELIKQVFKKVNKDLGIAAKTPPAQMKSFNEKLKAAPTPFLYRIKDVWKAFAALMAGFFTIGFIIARLTIPTEAVLQTAAVSPDIYDFNTFDSDGDGEWTLAEAQQAKLALAIQQFEYADRNQDAKLSF |
⦗Top⦘ |