Scaffold Ga0209124_10238240

Overview

Basic Information

• Taxon OID: 3300025852
• Scaffold ID: Ga0209124_10238240
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 706
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow, Alaska, USA
• Coordinates
  • Lat. (^o): 71.270939
  • Long. (^o): -156.810374

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012640	Metagenome / Metatranscriptome	279	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209124_102382402	F012640	GAG	MSQAFTFIDIAGNRAQYTVSEKDYHSDFHWSTDHGDHGVAPSFEEAQLRARTVLKDSMAVNRRSDEATRMSKYSIRWRSH