| Basic Information | |
|---|---|
| Taxon OID | 3300025843 Open in IMG/M |
| Scaffold ID | Ga0209182_10183660 Open in IMG/M |
| Source Dataset Name | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 586 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russia: Lake Baikal | |||||||
| Coordinates | Lat. (o) | 53.7598 | Long. (o) | 107.9791 | Alt. (m) | Depth (m) | 0 to .05 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031070 | Metagenome / Metatranscriptome | 183 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209182_101836601 | F031070 | N/A | MRTHKTNFRKRSPYWNFFRVVLAGWMIRYPKQTVFVPLGFLLVLIYN |
| ⦗Top⦘ |