Basic Information | |
---|---|
Taxon OID | 3300025787 Open in IMG/M |
Scaffold ID | Ga0210047_1074429 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from aquifer - Crystal Geyser CG01_land_8/20/14_3.00 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 776 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → Candidatus Altiarchaeales → Candidatus Altiarchaeum → unclassified Candidatus Altiarchaeum → Candidatus Altiarchaeum sp. CG2_30_32_3053 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah: Grand County | |||||||
Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000320 | Metagenome / Metatranscriptome | 1306 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210047_10744291 | F000320 | N/A | MQATMKNTKMPPSKEYKSEALGREIIRKINQIGEKTYKLKKDVNDVCGIILRKPGGTFFFEGRKAELWKEASDDFSKQWKEIGAEKYEVECMIHRMYDLVLQKEEK |
⦗Top⦘ |