| Basic Information | |
|---|---|
| Taxon OID | 3300025785 Open in IMG/M |
| Scaffold ID | Ga0208498_1028568 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 894 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Crystal Bog, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.0072 | Long. (o) | -89.6063 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082118 | Metagenome / Metatranscriptome | 113 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208498_10285681 | F082118 | N/A | ELEAQQVELRQNQLNVVVQLQERNIDPEEEALLREQLELLSKLEVPIHMLLARYKGKERKEKQKRTSRRQAIRII |
| ⦗Top⦘ |