NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208699_1040680

Scaffold Ga0208699_1040680


Overview

Basic Information
Taxon OID3300025776 Open in IMG/M
Scaffold IDGa0208699_1040680 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Pacific Ocean - MP2097 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)533
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
unclassified Hyphomonas → Hyphomonas sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameNorth Pacific Ocean
CoordinatesLat. (o)14.53Long. (o)-118.77Alt. (m)Depth (m)294
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016692Metagenome / Metatranscriptome245Y

Sequences

Protein IDFamilyRBSSequence
Ga0208699_10406802F016692AGGAGMAYIGQPPLQEFTSPPTKDTFTGNGSLTYFDLAQEVVSGGEYALEVFIDNVRQEPGTGKSFTLGNDGSDANKRITFTAAPANGAVIYVLNDKTNLTAIAPTATDLNGVELILDANADT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.