| Basic Information | |
|---|---|
| Taxon OID | 3300025767 Open in IMG/M |
| Scaffold ID | Ga0209137_1060083 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1733 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Saanich Inlet, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041218 | Metagenome / Metatranscriptome | 160 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209137_10600832 | F041218 | N/A | MSCQPRWVNSASYRFANNAQLVQNESLTILKHKDATSMGQFGQILTFNDQAAGMGHLALFSVKDGHIEFYQFISSSSPSYSVNFQDGLMEVFQGIISSEANETHSLPAGPHYHPVMATHYPLVVDAIWRLKVGEEHLLSMVQPPKGNISVASYYLAQKTSKERIYLYRNDSNVGTLTYQKHKGRWVLQKVDLMNQDVPYVWERMEAP |
| ⦗Top⦘ |