NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208784_1011300

Scaffold Ga0208784_1011300


Overview

Basic Information
Taxon OID3300025732 Open in IMG/M
Scaffold IDGa0208784_1011300 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3023
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020529Metagenome / Metatranscriptome223Y
F022636Metagenome / Metatranscriptome213N
F041152Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
Ga0208784_10113002F041152GAGMNIVDYIVKNWDTLPKSKFDDDRIVIFKEIENDDWGYGHHSYEGIGVDKDGNVTWCYSSGCSCSGGPSLETKKDLKVFVVNEGIDLNVDPSTINFGSLQVEFNSY
Ga0208784_10113004F020529AGGAGMFSNKNIVKYCAKYFVLLTVGAYVFNTSVIFINQKSDVANLIGSALFAGLFIGSLLILKSDVTKLVKNLNENKEKKQNEE
Ga0208784_10113005F022636N/AMSTYRRATLQDLAKLGYVPNAQKYSEHIEFARKYYPPEATTMVMSIHSEYNDSTYDNSFQYIIVYDTEGNELPPLKKTAKECREHWTTEYLPIPNTSHGHYGASESDEPLEDVVIPLTSEVPELYIKEN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.