NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208784_1003013

Scaffold Ga0208784_1003013


Overview

Basic Information
Taxon OID3300025732 Open in IMG/M
Scaffold IDGa0208784_1003013 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6566
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (52.17%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008402Metagenome / Metatranscriptome334Y
F037722Metagenome / Metatranscriptome167Y
F063620Metagenome / Metatranscriptome129N
F077968Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0208784_10030131F008402N/ADYWYTVEDTHIDVGCPGCTISYWELPSGMSTIDKRIQHICMDKEEAFAIADAIYKLFKKN
Ga0208784_100301310F063620N/AMTNSITPKVAYIPLEYHMSVEDFLKIWKDMEMEDEPTQEDYDAFVLETGKSYFYDMRGELELHIRLEDA
Ga0208784_100301316F077968GGAGMTDTWKKWNIYTSIYLFEYCVFSWRNHMWNHLDGFEDDEVIMRGLFWYYLNYGNINTYYK
Ga0208784_10030134F037722GAGGMTKHEIGATIGFYIFVGVLGWALVSFFSLTWAQALTISWMYSKLIDVLQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.