| Basic Information | |
|---|---|
| Taxon OID | 3300025708 Open in IMG/M |
| Scaffold ID | Ga0209201_1025907 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2874 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA | |||||||
| Coordinates | Lat. (o) | 41.53 | Long. (o) | -90.43 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076001 | Metagenome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209201_10259071 | F076001 | N/A | NTKMNNRYKNAIAGRVNPDIRNKVQPLIEKFAQENQLPFNTVFGAAMFAAERLKGRVTCARVEALVTAATVQAYELEMQRRTTARKVQITGIIRRALPVAKRTTEVIEKLYSQFCGFQGSIPALMQQVQAAASAV |
| ⦗Top⦘ |