Scaffold Ga0209744_1084356

Overview

Basic Information

• Taxon OID: 3300025692
• Scaffold ID: Ga0209744_1084356
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1118
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 71.28381
  • Long. (^o): -156.5985

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051902	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209744_10843561	F051902	GAGG	MQIRVLRSIGRFLEGTGDVVGTPSGDTRGLIRVYTQDTVTRGRNF