NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208826_1147156

Scaffold Ga0208826_1147156


Overview

Basic Information
Taxon OID3300025691 Open in IMG/M
Scaffold IDGa0208826_1147156 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)686
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.28Long. (o)114.17Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016798Metagenome / Metatranscriptome244Y
F091896Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0208826_11471561F016798AGGAGMKKLILILLLLTLVSCEKEFKELQCSYVISNFIELNDDLDYKLVYFCDKYDAFEHFYDIKHTIFNEIGEHNYYKNSQERMSIVSFTKDTGTCQFQHKTFYYLAEKYDIKGANILSENQQIAVMVQAFRDDKKNYWNGYKKLKKILVE
Ga0208826_11471562F091896N/ACLIQNNLYTNIINIQDSVISLKDSVNASLEDMYKQKVKKVKRQRNVATSIAFTEFLILIGVLAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.