Scaffold Ga0208826_1052543

Overview

Basic Information

• Taxon OID: 3300025691
• Scaffold ID: Ga0208826_1052543
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1390
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin035 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Hong Kong
• Coordinates
  • Lat. (^o): 22.28
  • Long. (^o): 114.17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013091	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208826_10525432	F013091	AGGAG	MACKLTNGIRLKDCDTPGGVSESYFINIEDVDTLTVTDFQVSALTLKSTATAYKIAFEPQTSNFASNAVGSVENSSAAYEQTCEIKINKIDNNVLEQIDALTKGRHLVIIQKNDKTYEMYFHEGGAKFVANYSTGTAFEDPSGVTLTATHRQPSNMLIVSATVIPTLTIAEETP