NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208695_1021449

Scaffold Ga0208695_1021449


Overview

Basic Information
Taxon OID3300025678 Open in IMG/M
Scaffold IDGa0208695_1021449 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2895
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (36.36%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.28Long. (o)114.17Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082381Metagenome113Y
F086799Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0208695_10214492F082381GAGMVVLEGKKGGKRKGAGRKPAPYQTKTIAFRIRVEWAEVIKSTVKAKVAELSQNSS
Ga0208695_10214495F086799N/AMKANKIVYSRLISKGNYENAKIEIELEVEAGEKASEVFEAAKKWVEKRIAVEKLSDYTIEKARKVMDDKRNHTLAQIEEAEEILAKAKVDDELPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.