Scaffold Ga0208695_1002489

Overview

Basic Information

• Taxon OID: 3300025678
• Scaffold ID: Ga0208695_1002489
• Source Dataset Name: Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 13375
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (21.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Hong Kong
• Coordinates
  • Lat. (^o): 22.28
  • Long. (^o): 114.17

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069913	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208695_10024896	F069913	N/A	MTLEEYELLEKDFLTSSTDIRTFLEAKGLSPHKYYYWKRRSRELKEASSIADGQFLPIDLHSGGLIKPSGRGKSTRQPVIGQGEIEIELRTPSGAELRIRGIMDSLMVSSIIASSGSRRN