| Basic Information | |
|---|---|
| Taxon OID | 3300025665 Open in IMG/M |
| Scaffold ID | Ga0209360_1064936 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1168 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Saanich Inlet, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015796 | Metagenome / Metatranscriptome | 252 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209360_10649361 | F015796 | AGG | MNKQQMKRYDDTRDRVLIREWFKLKNVVLEHGSKYGVDLKGKDYDIEISHLSFSNLWEQWKKENRFRIEIRKRNHYWDGIYNESKTTHFVQLNKSGHELLVYPQDLIMEYSNNEVELGYLRSKGFNLKERTFMFIPFNIGKDVIKRY |
| ⦗Top⦘ |