Scaffold Ga0208905_1111287

Overview

Basic Information

• Taxon OID: 3300025661
• Scaffold ID: Ga0208905_1111287
• Source Dataset Name: Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 810
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Ace Lake
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094387	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208905_11112873	F094387	AGG	MKTIKYNNKTIKLPFVGADYSNPFAMETISNPMSGESIAMPRFAVAVYDVTMGSQQIASAYDITHG